Structure of PDB 8yzt Chain A |
>8yztA (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] |
ITLNSEEDYPNGTWLGDENNPEMRVRCAIIPSDMLHISTNCRTAEKMALT LLDYLFHREVQAVSNLSGQGKHGKKQLDPLTIYGIRCHLFYKFGITESDW YRIKQSIDSKCRTAWRRKQR |
|
PDB | 8yzt Structural basis of DNA recognition by BEN domain proteins reveals a role for oligomerization in unmethylated DNA selection by BANP. |
Chain | A |
Resolution | 2.58 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
A |
K250 L253 K314 |
K46 L49 K110 |
|
|
|