Structure of PDB 8wrx Chain A |
>8wrxA (length=86) Species: 2547993 (Streptococcus phage Javan128) [Search protein sequence] |
MKTIFTKKQTEELLNDISIEKQKELFNSMHDFRSQHAKEARIPGWSDKYN KLEKKMLSDFEEVTGIKYDTLESELIWDNLSNKFLY |
|
PDB | 8wrx AcrIIA28 is a metalloprotein that specifically inhibits targeted-DNA loading to SpyCas9 by binding to the REC3 domain. |
Chain | A |
Resolution | 1.45 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
G44 W45 |
G44 W45 |
|
|
|