Structure of PDB 8wll Chain A

Receptor sequence
>8wllA (length=389) Species: 9606 (Homo sapiens) [Search protein sequence]
RSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEDLLNENVQVGLL
FASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAF
LLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLV
GPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTP
LTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAF
LPASISYLIGTNIFGILAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGL
IAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVCAIADVAFCMGYA
IGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSP
3D structure
PDB8wll Cryo-EM structure of human VMAT2 Y422C, in the presence of reserpine, determined in an inward-facing conformation
ChainA
Resolution3.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 YHR A L225 L228 V232 I308 E312 F334 Y341 M403 F429 Y433 L141 L144 V148 I224 E228 F250 Y257 M319 F345 Y349
Gene Ontology
Molecular Function
GO:0005335 serotonin:sodium:chloride symporter activity
GO:0005515 protein binding
GO:0008504 monoamine transmembrane transporter activity
GO:0015311 monoamine:proton antiporter activity
Biological Process
GO:0001975 response to amphetamine
GO:0002552 serotonin secretion by mast cell
GO:0002553 histamine secretion by mast cell
GO:0006836 neurotransmitter transport
GO:0007268 chemical synaptic transmission
GO:0007626 locomotory behavior
GO:0009636 response to toxic substance
GO:0009791 post-embryonic development
GO:0015842 aminergic neurotransmitter loading into synaptic vesicle
GO:0015844 monoamine transport
GO:0015872 dopamine transport
GO:0042137 sequestering of neurotransmitter
GO:0051610 serotonin uptake
GO:0051615 histamine uptake
GO:0098700 neurotransmitter loading into synaptic vesicle
GO:0099123 somato-dendritic dopamine secretion
GO:1902600 proton transmembrane transport
GO:1903427 negative regulation of reactive oxygen species biosynthetic process
Cellular Component
GO:0005813 centrosome
GO:0005886 plasma membrane
GO:0008021 synaptic vesicle
GO:0016020 membrane
GO:0030424 axon
GO:0030425 dendrite
GO:0030667 secretory granule membrane
GO:0030672 synaptic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection
GO:0043195 terminal bouton
GO:0043231 intracellular membrane-bounded organelle
GO:0045202 synapse
GO:0070083 clathrin-sculpted monoamine transport vesicle membrane
GO:0098691 dopaminergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wll, PDBe:8wll, PDBj:8wll
PDBsum8wll
PubMed
UniProtQ05940|VMAT2_HUMAN Synaptic vesicular amine transporter (Gene Name=SLC18A2)

[Back to BioLiP]