Structure of PDB 8wh5 Chain A

Receptor sequence
>8wh5A (length=94) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
FRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVA
ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB8wh5 Molecular basis of chromatin remodelling by DDM1 involved in plant DNA methylation.
ChainA
Resolution3.58 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A V46 A47 R63 L65 R83 V6 A7 R23 L25 R43
BS02 dna A F41 R42 R83 T118 F1 R2 R43 T78
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009536 plastid
GO:0010369 chromocenter

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8wh5, PDBe:8wh5, PDBj:8wh5
PDBsum8wh5
PubMed38413824
UniProtP59226|H31_ARATH Histone H3.1 (Gene Name=HTR2)

[Back to BioLiP]