Structure of PDB 8wgu Chain A |
>8wguA (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] |
CPLMVKVLDAVRGSPAINVAMHVFRKAADDTWEPFASGKTSESGELHGLT TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA LLSPYSYSTTAVVTN |
|
PDB | 8wgu Development of Benziodarone Analogues with Enhanced Potency for Selective Binding to Transthyretin in Human Plasma. |
Chain | A |
Resolution | 1.508 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
WH0 |
A |
K15 A108 A109 S117 |
K6 A99 A100 S108 |
|
|
|