Structure of PDB 8wdx Chain A

Receptor sequence

>8wdxA (length=134) Species: 9606 (Homo sapiens) [Search protein sequence]

SHMCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGD
VITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKW
DGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA

3D structure

PDB

8wdx Structure-based design of potent FABP4 inhibitors with high selectivity against FABP3.

Chain

Resolution

1.65 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	W6K	A	F16 A33 F57 I104 V115 R126 Y128	F19 A36 F60 I107 V118 R129 Y131

Gene Ontology

	Molecular Function
GO:0005324	long-chain fatty acid transmembrane transporter activity
GO:0005504	fatty acid binding
GO:0008289	lipid binding
GO:0036041	long-chain fatty acid binding
GO:0051427	hormone receptor binding

	Biological Process
GO:0009617	response to bacterium
GO:0015908	fatty acid transport
GO:0015909	long-chain fatty acid transport
GO:0042632	cholesterol homeostasis
GO:0045892	negative regulation of DNA-templated transcription
GO:0050729	positive regulation of inflammatory response
GO:0050872	white fat cell differentiation
GO:0050873	brown fat cell differentiation
GO:0071285	cellular response to lithium ion
GO:0071356	cellular response to tumor necrosis factor
GO:0120162	positive regulation of cold-induced thermogenesis

External links

PDB	RCSB:8wdx, PDBe:8wdx, PDBj:8wdx
PDBsum	8wdx
PubMed	38043490
UniProt	P15090\|FABP4_HUMAN Fatty acid-binding protein, adipocyte (Gene Name=FABP4)