Structure of PDB 8w5z Chain A

Receptor sequence

>8w5zA (length=333) Species: 6944 (Ixodes)

NFTYVSPDRYVLGPDSRRYPYNNDMPLIFIGGMPRSGTTLVRVLLDAHPD
VRCGEETRVIPRLLSLKQQWVKNPTEMHRLLEGGITDEVLDAAMSAFILE
VIVRHGKPAPRLCNKDPFTLRAAVYLHRLFPRAKFLLMIRDGRAVVHSII
TRKVTITGYDLSDYRQCLKRWNAAMTSMYAQCQQLGPGLCLPVYYEQLVL
HPRAWMQRILAFLEVPWNDSVLHHEQLINQSGIALSKLERSTDQVIKPIN
LGALSKWVGHIPEDVVRDMAKVAPMLAQLGYDPAANPPDYGQPDNFVLNN
TLEIKKKMEEWQARERELEEHRELIKQSIAKKK

3D structure

• PDB: 8w5z Crystal structure of tick tyrosylprotein sulfotransferase reveals the activation mechanism of the tick anticoagulant protein madanin.
• Chain: A
• Resolution: 1.55 Å

Enzymatic activity

• Enzyme Commision number: 2.8.2.20: protein-tyrosine sulfotransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	P73 E95 R97 R101 P156 F157 R160 T194 T196 Y198 R279	P34 E56 R58 R62 P117 F118 R121 T155 T157 Y159 R240
BS02	A3P	A	R74 S75 G76 T77 T78 R179 S187 R191 Y234 S280 Q283 V284 P287 N289 A292 K295	R35 S36 G37 T38 T39 R140 S148 R152 Y195 S241 Q244 V245 P248 N250 A253 K256
BS03	1PS	A	Y233 R247 Q317 L318	Y194 R208 Q278 L279
BS04	1PS	A	G298 I300 P301	G259 I261 P262
BS05	1PS	A	Y233 Q236 G319 Y320 D328 Y329	Y194 Q197 G280 Y281 D289 Y290
BS06	1PS	A	R167 Q220	R128 Q181

Gene Ontology

Molecular Function

• GO:0008476 protein-tyrosine sulfotransferase activity

Biological Process

• GO:0006478 peptidyl-tyrosine sulfation

External links

• PDB: RCSB:8w5z, PDBe:8w5z, PDBj:8w5z
• PDBsum: 8w5z
• PubMed: 38354785
• UniProt: B7Q097