Structure of PDB 8w34 Chain A

Receptor sequence

>8w34A (length=261) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence]

FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAM
HGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYF
LLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGV
IESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERI
VDIIATDIQTKELQKQITKIQNFRVYYRKGPAKLLWKGEGAVVIQDNSDI
KVVPRRKAKII

3D structure

PDB

8w34 HIV-1 integrase assembles multiple species of stable synaptic complex intasomes that are active for concerted DNA integration in vitro.

Chain

Resolution

2.83 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	H51 G52 Q53 V54 G140 I141 Q146 S147 G149 V150 S153 E157	H51 G52 Q53 V54 G140 I141 Q146 S147 G149 V150 S153 E157
BS02	dna	A	T66 E152 S153 K156 K159	T66 E152 S153 K156 K159
BS03	dna	A	P30 A49 M50 H51	P30 A49 M50 H51
BS04	ZN	A	H12 H16 C40 C43	H12 H16 C40 C43
BS05	DLU	A	D64 D116 P145 Q146 E152	D64 D116 P145 Q146 E152
BS06	MG	A	D64 D116	D64 D116
BS07	MG	A	D64 E152	D64 E152

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0008270	zinc ion binding

	Biological Process
GO:0015074	DNA integration

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8w34, PDBe:8w34, PDBj:8w34
PDBsum	8w34
PubMed	38582148
UniProt	P12497\|POL_HV1N5 Gag-Pol polyprotein (Gene Name=gag-pol)

[Back to BioLiP]