Structure of PDB 8w2o Chain A

Receptor sequence
>8w2oA (length=169) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
DVSRLFKPRPPLSYKRPTDYPYAKRQTNPNITGVANLLSTSLKHYMEEFP
EGSPNNHLQRYEDIKLSKIKNAQLLDRRLHIKDTDPYRTIFIGRLPYDLD
EIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEIG
VHRGIQIKDRICIVDIERG
3D structure
PDB8w2o Selected humanization of yeast U1 snRNP leads to global suppression of pre-mRNA splicing and mitochondrial dysfunction in the budding yeast.
ChainA
Resolution3.49 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A Y30 K34 R35 Q36 T37 N38 P39 N40 N81 Y20 K24 R25 Q26 T27 N28 P29 N30 N71
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0030619 U1 snRNA binding
Biological Process
GO:0000395 mRNA 5'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005685 U1 snRNP
GO:0071004 U2-type prespliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8w2o, PDBe:8w2o, PDBj:8w2o
PDBsum8w2o
PubMed38688558
UniProtQ00916|RU17_YEAST U1 small nuclear ribonucleoprotein 70 kDa homolog (Gene Name=SNP1)

[Back to BioLiP]