Structure of PDB 8w0u Chain A

Receptor sequence

>8w0uA (length=398) Species: 9606 (Homo sapiens) [Search protein sequence]

EERLETPSAKKLTDIGIRRIFSPEHDIFRKSVRKFFQEEVIPHHSEWEKA
GEVSREVWEKAGKQGLLGVNIAEHLGGIGGDLYSAAIVWEEQAYSNCSGP
GFSIHSGIVMSYITNHGSEEQIKHFIPQMTAGKCIGAIAMTEPGAGSDLQ
GIKTNAKKDGSDWILNGSKVFISNGSLSDVVIVVAVTNHEAPSPAHGISL
FLVENGMKGFIKGRKLHKMGLKAQDTAELFFEDIRLPASALLGEENKGFY
YIMKELPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQH
KLAELKTHICVTRAFVDNCLQLHEAKRLDSATACMAKYWASELQNSVAYD
CVQLHGGWGYMWEYPIAKAYVDARVQPIYGGTNEIMKELIAREIVFDK

3D structure

PDB

8w0u Structural basis for expanded substrate specificities of human long chain acyl-CoA dehydrogenase and related acyl-CoA dehydrogenases.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FAD	A	I170 M172 T173 G178 S179 F203 S205 V407 Y411 T414 E416	I138 M140 T141 G146 S147 F171 S173 V375 Y379 T382 E384
BS02	CAA	A	M172 S179 Q182 S225 H228 Y282 E291 R292 Y411 G412 G413 I417 L421 R424	M140 S147 Q150 S193 H196 Y250 E259 R260 Y379 G380 G381 I385 L389 R392
BS03	FAD	A	R317 F320 L327 Q385 L386 G389	R285 F288 L295 Q353 L354 G357

Gene Ontology

	Molecular Function
GO:0000062	fatty-acyl-CoA binding
GO:0004466	long-chain fatty acyl-CoA dehydrogenase activity
GO:0005515	protein binding
GO:0016401	palmitoyl-CoA oxidase activity
GO:0016491	oxidoreductase activity
GO:0042802	identical protein binding
GO:0050660	flavin adenine dinucleotide binding

	Biological Process
GO:0001659	temperature homeostasis
GO:0006631	fatty acid metabolic process
GO:0019254	carnitine metabolic process, CoA-linked
GO:0033539	fatty acid beta-oxidation using acyl-CoA dehydrogenase
GO:0042413	carnitine catabolic process
GO:0042758	long-chain fatty acid catabolic process
GO:0044242	cellular lipid catabolic process
GO:0045717	negative regulation of fatty acid biosynthetic process
GO:0046322	negative regulation of fatty acid oxidation
GO:0090181	regulation of cholesterol metabolic process
GO:0120162	positive regulation of cold-induced thermogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix
GO:0031966	mitochondrial membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8w0u, PDBe:8w0u, PDBj:8w0u
PDBsum	8w0u
PubMed	38839792
UniProt	P28330\|ACADL_HUMAN Long-chain specific acyl-CoA dehydrogenase, mitochondrial (Gene Name=ACADL)

[Back to BioLiP]