Structure of PDB 8vzy Chain A

Receptor sequence

>8vzyA (length=133) Species: 9606 (Homo sapiens)

TRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTLVIDQDGDNFK
VKSTSTFYNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGE
KENRGWKKWIEGDKLYLELTCGDQVCRQVFKKK

3D structure

• PDB: 8vzy Regulation of Emission via a Protein-Bound Fluorophore
• Chain: A
• Resolution: 1.34 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	A1AEQ	A	Q38 S53 Y60 L77 W106 K108	Q38 S53 Y60 L77 W106 K108

Gene Ontology

Molecular Function

• GO:0005501 retinoid binding
• GO:0005504 fatty acid binding
• GO:0008289 lipid binding
• GO:0016918 retinal binding
• GO:0019841 retinol binding

Biological Process

• GO:0006776 vitamin A metabolic process
• GO:0008544 epidermis development
• GO:0015908 fatty acid transport

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:8vzy, PDBe:8vzy, PDBj:8vzy
• PDBsum: 8vzy
• PubMed: 39046136
• UniProt: P50120|RET2_HUMAN Retinol-binding protein 2 (Gene Name=RBP2)