Structure of PDB 8vm2 Chain A

Receptor sequence

>8vm2A (length=175) Species: 9606 (Homo sapiens)

LYFQGMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVV
IDGETCLLDILDTAGKEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINL
YREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETS
AKTRQGVEDAFYTLVREIRQYRMKK

3D structure

• PDB: 8vm2 Crystal structure of NRAS Q61K with a ligand-induced pocket near switch II.
• Chain: A
• Resolution: 1.74 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.2: small monomeric GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	A	G13 V14 G15 K16 S17 A18 F28 V29 D30 E31 Y32 P34 T35 G60 N116 K117 D119 S145 A146	G18 V19 G20 K21 S22 A23 F33 V34 D35 E36 Y37 P39 T40 G65 N121 K122 D124 S150 A151
BS02	MG	A	S17 T35	S22 T40
BS03	GTP	A	G60 E62 R68 K88 D92 L95 Y96 Q99	G65 E67 R73 K93 D97 L100 Y101 Q104
BS04	GTP	A	R97 E98 K101	R102 E103 K106

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0003925 G protein activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0016787 hydrolase activity
• GO:0019003 GDP binding
• GO:0044877 protein-containing complex binding

Biological Process

• GO:0000165 MAPK cascade
• GO:0001938 positive regulation of endothelial cell proliferation
• GO:0007165 signal transduction
• GO:0007265 Ras protein signal transduction
• GO:0045445 myoblast differentiation

Cellular Component

• GO:0000139 Golgi membrane
• GO:0005789 endoplasmic reticulum membrane
• GO:0005794 Golgi apparatus
• GO:0005829 cytosol
• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0070062 extracellular exosome
• GO:0070821 tertiary granule membrane

External links

• PDB: RCSB:8vm2, PDBe:8vm2, PDBj:8vm2
• PDBsum: 8vm2
• PubMed: 38640594
• UniProt: P01111|RASN_HUMAN GTPase NRas (Gene Name=NRAS)