Structure of PDB 8ve0 Chain A

Receptor sequence

>8ve0A (length=117) Species: 9606 (Homo sapiens)

KCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGL
TTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA
ALLSPYSYSTTAVVTNP

3D structure

• PDB: 8ve0 The conformational landscape of human transthyretin revealed by cryo-EM
• Chain: A
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	1WZ	A	K15 S117 T118	K7 S109 T110

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:8ve0, PDBe:8ve0, PDBj:8ve0
• PDBsum: 8ve0
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)