Structure of PDB 8vcw Chain A

Receptor sequence

>8vcwA (length=327) Species: 40520 (Blautia obeum)

MNPLTLAQEIIDGRRITREDDLSFFLTCDLDELCEGADRIREACIGDKVD
LCSIINGRSGRCPEDCKYCAQSAHHHTSCEVYNFLPEEKILEACKMNESE
GVDRFSIVTAGKALTGKEFDQAIHAYETMHRECKIDLCASMGFISAEQLH
RLHEAGVTSYHHNIETSRRNFPNICTTHTYDMKIETLKKVKAEGMCACSG
GIIGMGETWEDRLDMAISLAELGIDSIPINALMPIPGTPLEHLPELSEPD
ILRTIAFFRYINPEANIRLAAGRALLTNDGETAFKAGASASITGNMLTTV
ACATIRSDRKMLADMGRDVTPEYWKEV

3D structure

• PDB: 8vcw X-Ray Crystal Structure of the biotin synthase from B. obeum
• Chain: A
• Resolution: 1.35 Å

Enzymatic activity

• Enzyme Commision number: 2.8.1.6: biotin synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SAM	A	Y68 T109 S140 G142 H161 N163 E165 I202 M233	Y68 T109 S140 G142 H161 N163 E165 I202 M233
BS02	Q46	A	C52 R104 S106 C138 H161 C198 R268	C52 R104 S106 C138 H161 C198 R268
BS03	SF4	A	C62 E64 C66 Y68 C69 A110	C62 E64 C66 Y68 C69 A110
BS04	DTB	A	H161 P228 N230 I292 L297 T298 T299	H161 P228 N230 I292 L297 T298 T299

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004076 biotin synthase activity
• GO:0005506 iron ion binding
• GO:0016740 transferase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009102 biotin biosynthetic process
• GO:0042364 water-soluble vitamin biosynthetic process
• GO:0044272 sulfur compound biosynthetic process

External links

• PDB: RCSB:8vcw, PDBe:8vcw, PDBj:8vcw
• PDBsum: 8vcw
• PubMed: 38215281
• UniProt: A5ZUL4