Structure of PDB 8v4y Chain A

Receptor sequence
>8v4yA (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence]
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
VMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGE
3D structure
PDB8v4y Functionalized graphene-oxide grids enable high-resolution cryo-EM structures of the SNF2h-nucleosome complex without crosslinking.
ChainA
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R40 Y41 R49 R63 K64 P66 R83 R2 Y3 R11 R25 K26 P28 R45
BS02 dna A R42 R72 V117 T118 M120 R4 R34 V79 T80 M82
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8v4y, PDBe:8v4y, PDBj:8v4y
PDBsum8v4y
PubMed38472177
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]