Structure of PDB 8uqn Chain A

Receptor sequence

>8uqnA (length=315) Species: 9606 (Homo sapiens) [Search protein sequence]

RELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAM
QAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWN
DPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTT
GIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQ
VLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSH
LVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENI
RFVFAAVKDTILQLN

3D structure

PDB

8uqn The mechanism of G alpha q regulation of PLC beta 3 -catalyzed PIP2 hydrolysis.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	GDP	A	G51 K52 S53 T54 R181 R183 K275 D277 C330 A331	G14 K15 S16 T17 R144 R146 K238 D240 C293 A294
BS02	ALF	A	K52 P185 T186 G208 Q209	K15 P148 T149 G171 Q172
BS03	MG	A	S53 T186 D205	S16 T149 D168

Gene Ontology

	Molecular Function
GO:0001664	G protein-coupled receptor binding
GO:0003924	GTPase activity
GO:0003925	G protein activity
GO:0005096	GTPase activator activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0019001	guanyl nucleotide binding
GO:0030234	enzyme regulator activity
GO:0031683	G-protein beta/gamma-subunit complex binding
GO:0046872	metal ion binding

	Biological Process
GO:0001508	action potential
GO:0006469	negative regulation of protein kinase activity
GO:0007165	signal transduction
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007206	phospholipase C-activating G protein-coupled glutamate receptor signaling pathway
GO:0007208	phospholipase C-activating serotonin receptor signaling pathway
GO:0007213	G protein-coupled acetylcholine receptor signaling pathway
GO:0007215	glutamate receptor signaling pathway
GO:0007218	neuropeptide signaling pathway
GO:0007596	blood coagulation
GO:0007603	phototransduction, visible light
GO:0009649	entrainment of circadian clock
GO:0010543	regulation of platelet activation
GO:0034695	response to prostaglandin E
GO:0050821	protein stabilization
GO:0060158	phospholipase C-activating dopamine receptor signaling pathway
GO:0060828	regulation of canonical Wnt signaling pathway

	Cellular Component
GO:0001750	photoreceptor outer segment
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005765	lysosomal membrane
GO:0005794	Golgi apparatus
GO:0005834	heterotrimeric G-protein complex
GO:0005886	plasma membrane
GO:0031965	nuclear membrane
GO:0045202	synapse
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8uqn, PDBe:8uqn, PDBj:8uqn
PDBsum	8uqn
PubMed	37991948
UniProt	P50148\|GNAQ_HUMAN Guanine nucleotide-binding protein G(q) subunit alpha (Gene Name=GNAQ)

[Back to BioLiP]