Structure of PDB 8unw Chain A

Receptor sequence

>8unwA (length=231) Species: 9606 (Homo sapiens) [Search protein sequence]

RNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRI
GIFETKFQVDKVNFHMFDVGRDERRKWIQCFNDVTAIIFVVASSSYNMVT
NRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFP
EFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHF
TCAVDTENIRRVFNDCRDIIQRMHLRQYELL

3D structure

PDB

8unw Time-resolved cryo-EM of G protein activation by a GPCR

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	A	A48 G49 E50 S51 G52 S54	A36 G37 E38 S39 G40 S42

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0003925	G protein activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0010856	adenylate cyclase activator activity
GO:0016787	hydrolase activity
GO:0019001	guanyl nucleotide binding
GO:0031683	G-protein beta/gamma-subunit complex binding
GO:0031748	D1 dopamine receptor binding
GO:0046872	metal ion binding

	Biological Process
GO:0002862	negative regulation of inflammatory response to antigenic stimulus
GO:0003091	renal water homeostasis
GO:0007165	signal transduction
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007190	activation of adenylate cyclase activity
GO:0007191	adenylate cyclase-activating dopamine receptor signaling pathway
GO:0007608	sensory perception of smell
GO:0046907	intracellular transport
GO:0048589	developmental growth
GO:0050796	regulation of insulin secretion
GO:0050890	cognition
GO:0060348	bone development
GO:0060789	hair follicle placode formation
GO:0070527	platelet aggregation
GO:0071377	cellular response to glucagon stimulus
GO:0071380	cellular response to prostaglandin E stimulus
GO:0071870	cellular response to catecholamine stimulus
GO:0071880	adenylate cyclase-activating adrenergic receptor signaling pathway
GO:0120162	positive regulation of cold-induced thermogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005834	heterotrimeric G-protein complex
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0032588	trans-Golgi network membrane
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8unw, PDBe:8unw, PDBj:8unw
PDBsum	8unw
PubMed	38480881
UniProt	P63092\|GNAS2_HUMAN Guanine nucleotide-binding protein G(s) subunit alpha isoforms short (Gene Name=GNAS)

[Back to BioLiP]