Structure of PDB 8unq Chain A

Receptor sequence
>8unqA (length=239) Species: 9606 (Homo sapiens) [Search protein sequence]
EDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQ
MRIIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSY
NMVIDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGK
SKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDG
RHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
3D structure
PDB8unq Time-resolved cryo-EM of G protein activation by a GPCR
ChainA
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 GTP A E50 G52 K53 S54 N292 K293 D295 A366 E41 G43 K44 S45 N137 K138 D140 A211
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0010856 adenylate cyclase activator activity
GO:0016787 hydrolase activity
GO:0019001 guanyl nucleotide binding
GO:0031683 G-protein beta/gamma-subunit complex binding
GO:0031748 D1 dopamine receptor binding
GO:0046872 metal ion binding
Biological Process
GO:0002862 negative regulation of inflammatory response to antigenic stimulus
GO:0003091 renal water homeostasis
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007190 activation of adenylate cyclase activity
GO:0007191 adenylate cyclase-activating dopamine receptor signaling pathway
GO:0007608 sensory perception of smell
GO:0046907 intracellular transport
GO:0048589 developmental growth
GO:0050796 regulation of insulin secretion
GO:0050890 cognition
GO:0060348 bone development
GO:0060789 hair follicle placode formation
GO:0070527 platelet aggregation
GO:0071377 cellular response to glucagon stimulus
GO:0071380 cellular response to prostaglandin E stimulus
GO:0071870 cellular response to catecholamine stimulus
GO:0071880 adenylate cyclase-activating adrenergic receptor signaling pathway
GO:0120162 positive regulation of cold-induced thermogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005834 heterotrimeric G-protein complex
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0032588 trans-Golgi network membrane
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8unq, PDBe:8unq, PDBj:8unq
PDBsum8unq
PubMed38480881
UniProtP63092|GNAS2_HUMAN Guanine nucleotide-binding protein G(s) subunit alpha isoforms short (Gene Name=GNAS)

[Back to BioLiP]