Structure of PDB 8ujt Chain A

Receptor sequence

>8ujtA (length=424) Species: 9606 (Homo sapiens)

ATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVS
YEARAFGVTRSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASVEVME
IMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLP
QGPQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERET
GFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSL
GGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHD
PVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRND
NDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFTVIKNCNT
SGIQTEWSPPLTMLFLCATKFSAS

3D structure

• PDB: 8ujt Replication Bypass of the N -(2-Deoxy-d-erythro-pentofuranosyl)-urea DNA Lesion by Human DNA Polymerase eta.
• Chain: A
• Resolution: 2.31 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Q38 Y39 W42 S62 K86 R93 K293 K311 P316 K317 T318 I319 G320 C321 S322 K323 N324 P326 G327 R351	Q37 Y38 W41 S61 K85 R92 K285 K303 P308 K309 T310 I311 G312 C313 S314 K315 N316 P318 G319 R343
BS02	dna	A	S113 E116 K224 S257 G259 K261 L262 R377 L381 R382	S112 E115 K216 S249 G251 K253 L254 R369 L373 R374
BS03	DZ4	A	D13 M14 C16 F17 F18 Y52 R55 R61 D115 K231	D12 M13 C15 F16 F17 Y51 R54 R60 D114 K223
BS04	MG	A	D13 M14 D115	D12 M13 D114
BS05	MG	A	D13 D115 E116	D12 D114 E115

Gene Ontology

Molecular Function

• GO:0003684 damaged DNA binding

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:8ujt, PDBe:8ujt, PDBj:8ujt
• PDBsum: 8ujt
• PubMed: 38413007
• UniProt: Q9Y253|POLH_HUMAN DNA polymerase eta (Gene Name=POLH)