Structure of PDB 8u94 Chain A

Receptor sequence

>8u94A (length=201) Species: 1028307 (Klebsiella aerogenes KCTC 2190)

TYTVALTGGIGSGKSTVADEFAHLGVTVIDADIIARQVVEPGTPALLAIA
ERFGPQMINDDGSLNRRRLRERIFAHSEDKAWLNALLHPLIQQETRRQMQ
ASTSPYLLWVVPLLVENRLTDKADRILVVDVPKETQIERTIRRDGVSREH
AEHILAAQATREQRLAAADDVIENMGSADAVASHVARLHDKYLMLASQAA
S

3D structure

• PDB: 8u94 Crystal Structure of Dephospho-CoA kinase from Klebsiella aerogenes (ADP Bound)
• Chain: A
• Resolution: 1.4 Å

Enzymatic activity

• Enzyme Commision number: 2.7.1.24: dephospho-CoA kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	A	G20 S21 G22 K23 S24 T25 R148 R152 N183	G11 S12 G13 K14 S15 T16 R139 R143 N174

Gene Ontology

Molecular Function

• GO:0004140 dephospho-CoA kinase activity
• GO:0005524 ATP binding
• GO:0016301 kinase activity

Biological Process

• GO:0015937 coenzyme A biosynthetic process
• GO:0016310 phosphorylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:8u94, PDBe:8u94, PDBj:8u94
• PDBsum: 8u94
• UniProt: A0A0H3FR62