Structure of PDB 8u4v Chain A

Receptor sequence
>8u4vA (length=180) Species: 9606 (Homo sapiens) [Search protein sequence]
GLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNC
VVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKC
TNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVAS
GQKREMGASLYVGWAASGLLLLGGGLLCCN
3D structure
PDB8u4v Cryo-EM structures of a synthetic antibody against 22 kDa claudin-4 reveal its complex with
ChainA
Resolution2.99 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AV0 A L27 M29 W47 M62 L23 M25 W43 M58
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0005198 structural molecule activity
GO:0005254 chloride channel activity
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0006821 chloride transport
GO:0007155 cell adhesion
GO:0007565 female pregnancy
GO:0007623 circadian rhythm
GO:0016338 calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules
GO:0022604 regulation of cell morphogenesis
GO:0030335 positive regulation of cell migration
GO:0032570 response to progesterone
GO:0034220 monoatomic ion transmembrane transport
GO:0061436 establishment of skin barrier
GO:0070293 renal absorption
GO:0070830 bicellular tight junction assembly
GO:0090303 positive regulation of wound healing
GO:0160184 paracellular transport
GO:1902476 chloride transmembrane transport
GO:1905050 positive regulation of metallopeptidase activity
Cellular Component
GO:0005886 plasma membrane
GO:0005911 cell-cell junction
GO:0005923 bicellular tight junction
GO:0009925 basal plasma membrane
GO:0016020 membrane
GO:0016324 apical plasma membrane
GO:0016327 apicolateral plasma membrane
GO:0016328 lateral plasma membrane
GO:0034707 chloride channel complex
GO:0070160 tight junction

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8u4v, PDBe:8u4v, PDBj:8u4v
PDBsum8u4v
PubMed38886509
UniProtO14493|CLD4_HUMAN Claudin-4 (Gene Name=CLDN4)

[Back to BioLiP]