Structure of PDB 8twe Chain A

Receptor sequence
>8tweA (length=387) Species: 9606 (Homo sapiens) [Search protein sequence]
SLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDT
IYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKA
VESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRV
SSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPM
FSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWR
VRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKE
FCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGK
DNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVI
3D structure
PDB8twe Real-space refinement in PHENIX for cryo-EM and crystallography.
ChainA
Resolution2.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A W257 R258 M262 H340 W249 R250 M254 H332
Gene Ontology
Molecular Function
GO:0004722 protein serine/threonine phosphatase activity
GO:0005515 protein binding
GO:0019888 protein phosphatase regulator activity
GO:0046982 protein heterodimerization activity
GO:1990405 protein antigen binding
Biological Process
GO:0007059 chromosome segregation
GO:0007143 female meiotic nuclear division
GO:0035331 negative regulation of hippo signaling
GO:0035556 intracellular signal transduction
GO:0040008 regulation of growth
GO:0043029 T cell homeostasis
GO:0045595 regulation of cell differentiation
GO:0051232 meiotic spindle elongation
GO:0051306 mitotic sister chromatid separation
GO:0051754 meiotic sister chromatid cohesion, centromeric
GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0065003 protein-containing complex assembly
GO:1903538 regulation of meiotic cell cycle process involved in oocyte maturation
GO:2001241 positive regulation of extrinsic apoptotic signaling pathway in absence of ligand
Cellular Component
GO:0000159 protein phosphatase type 2A complex
GO:0000775 chromosome, centromeric region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0015630 microtubule cytoskeleton
GO:0016020 membrane
GO:0016328 lateral plasma membrane
GO:0030425 dendrite
GO:0042995 cell projection
GO:0043005 neuron projection
GO:0043025 neuronal cell body
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:0090443 FAR/SIN/STRIPAK complex
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8twe, PDBe:8twe, PDBj:8twe
PDBsum8twe
PubMed38123684
UniProtP30153|2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform (Gene Name=PPP2R1A)

[Back to BioLiP]