Structure of PDB 8t9h Chain A

Receptor sequence
>8t9hA (length=96) Species: 8355 (Xenopus laevis) [Search protein sequence]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB8t9h Catalytic and non-catalytic mechanisms of histone H4 lysine 20 methyltransferase SUV420H1
ChainA
Resolution3.37 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R72 F84 R116 V117 T118 R33 F45 R77 V78 T79
BS02 dna A R40 Y41 V46 R63 K64 L65 P66 R69 R1 Y2 V7 R24 K25 L26 P27 R30
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8t9h, PDBe:8t9h, PDBj:8t9h
PDBsum8t9h
PubMed36993485
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]