Structure of PDB 8t9f Chain A

Receptor sequence
>8t9fA (length=96) Species: 8355 (Xenopus laevis) [Search protein sequence]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB8t9f Catalytic and non-catalytic mechanisms of histone H4 lysine 20 methyltransferase SUV420H1.
ChainA
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R40 R72 F84 R116 V117 T118 R1 R33 F45 R77 V78 T79
BS02 dna A R40 Y41 P43 V46 R63 L65 R69 R1 Y2 P4 V7 R24 L26 R30
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8t9f, PDBe:8t9f, PDBj:8t9f
PDBsum8t9f
PubMed37595555
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]