Structure of PDB 8t69 Chain A

Receptor sequence

>8t69A (length=386) Species: 9606 (Homo sapiens) [Search protein sequence]

RKLILFIVFLALLLDNMLLTVVVPIIPSYLYDLLNENVQVGLLFASKATV
QLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSL
QGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGSV
LYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKD
PYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISY
LIGTNIFGILAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGV
GFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGG
AIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKE

3D structure

PDB

8t69 Mechanisms of neurotransmitter transport and drug inhibition in human VMAT2

Chain

Resolution

2.89 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	YHL	A	L37 F135 R189 E312 F334 Y433	L19 F44 R98 E221 F243 Y342

Gene Ontology

	Molecular Function
GO:0005335	serotonin:sodium:chloride symporter activity
GO:0005515	protein binding
GO:0008504	monoamine transmembrane transporter activity
GO:0015311	monoamine:proton antiporter activity
GO:0022857	transmembrane transporter activity
GO:0042910	xenobiotic transmembrane transporter activity

	Biological Process
GO:0001975	response to amphetamine
GO:0002552	serotonin secretion by mast cell
GO:0002553	histamine secretion by mast cell
GO:0006836	neurotransmitter transport
GO:0007268	chemical synaptic transmission
GO:0007626	locomotory behavior
GO:0009636	response to toxic substance
GO:0009791	post-embryonic development
GO:0015842	aminergic neurotransmitter loading into synaptic vesicle
GO:0015844	monoamine transport
GO:0015872	dopamine transport
GO:0042137	sequestering of neurotransmitter
GO:0042908	xenobiotic transport
GO:0051610	serotonin uptake
GO:0051615	histamine uptake
GO:0055085	transmembrane transport
GO:0098700	neurotransmitter loading into synaptic vesicle
GO:0099123	somato-dendritic dopamine secretion
GO:1902600	proton transmembrane transport
GO:1903427	negative regulation of reactive oxygen species biosynthetic process

	Cellular Component
GO:0005813	centrosome
GO:0005886	plasma membrane
GO:0008021	synaptic vesicle
GO:0016020	membrane
GO:0030424	axon
GO:0030425	dendrite
GO:0030667	secretory granule membrane
GO:0030672	synaptic vesicle membrane
GO:0031410	cytoplasmic vesicle
GO:0042995	cell projection
GO:0043195	terminal bouton
GO:0043231	intracellular membrane-bounded organelle
GO:0045202	synapse
GO:0070083	clathrin-sculpted monoamine transport vesicle membrane
GO:0098691	dopaminergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8t69, PDBe:8t69, PDBj:8t69
PDBsum	8t69
PubMed	37914936
UniProt	Q05940\|VMAT2_HUMAN Synaptic vesicular amine transporter (Gene Name=SLC18A2)

[Back to BioLiP]