Structure of PDB 8t4r Chain A

Receptor sequence
>8t4rA (length=75) Species: 9606 (Homo sapiens) [Search protein sequence]
SGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLA
ERTLIHLSAGSNKYYCNEHVEIARA
3D structure
PDB8t4r Trimethyllysine Reader Proteins Exhibit Widespread Charge-Agnostic Binding via Different Mechanisms to Cationic and Neutral Ligands.
ChainA
Resolution1.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A G414 Y415 T436 A442 M443 I444 Y445 W453 L469 S470 G472 N474 G2 Y3 T24 A30 M31 I32 Y33 W41 L57 S58 G60 N62
BS02 ZN A C419 C423 H455 C458 C7 C11 H43 C46
BS03 ZN A C446 H452 C478 H481 C34 H40 C66 H69
Gene Ontology
Biological Process
GO:0006310 DNA recombination
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8t4r, PDBe:8t4r, PDBj:8t4r
PDBsum8t4r
PubMed38266163
UniProtP55895|RAG2_HUMAN V(D)J recombination-activating protein 2 (Gene Name=RAG2)

[Back to BioLiP]