Structure of PDB 8t0c Chain A

Receptor sequence

>8t0cA (length=532) Species: 10116 (Rattus norvegicus) [Search protein sequence]

YYKGQTALHIAIERRNMTLVTLLVENGADVQAAANGDFFKKTKGRPGFYF
GELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEVADN
TVDNTKFVTSMYNEILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIG
VLAYILQREIHEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLE
VIAYSSSETPNRHDMLLVEPLNRLLQDKWDRFVKRIFYFNFFVYCLYMII
FTAAAYYRPVEGLPPYKLKNTVGDYFRVTGEILSVSGGVYFFFRGIQYFL
QRRPSLKSLFVDSYSEILFFVQSLFMLVSVVLYFSQRKEYVASMVFSLAM
GWTNMLYYTRGFQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAVVT
LIEDGKYNSLYSTCLELFKFTIGMGDLEFTENYDFKAVFIILLLAYVILT
YILLLNMLIALMGETVNKIAQESKNIWKLQRAITILDTEKSFLKCMRKAF
RSGKLLQVGFTPDGKDDYRWCFRVDEVNWTTW

3D structure

PDB

8t0c Structural basis of TRPV1 modulation by endogenous bioactive lipids.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NKN	A	Y511 S512 L515 F543 T550 N551 L553 Y554	Y314 S315 L318 F346 T353 N354 L356 Y357

Gene Ontology

	Molecular Function
GO:0004888	transmembrane signaling receptor activity
GO:0005216	monoatomic ion channel activity
GO:0005230	extracellular ligand-gated monoatomic ion channel activity
GO:0005231	excitatory extracellular ligand-gated monoatomic ion channel activity
GO:0005261	monoatomic cation channel activity
GO:0005262	calcium channel activity
GO:0005515	protein binding
GO:0005516	calmodulin binding
GO:0005524	ATP binding
GO:0008289	lipid binding
GO:0008324	monoatomic cation transmembrane transporter activity
GO:0015276	ligand-gated monoatomic ion channel activity
GO:0015278	intracellularly gated calcium channel activity
GO:0017081	chloride channel regulator activity
GO:0035091	phosphatidylinositol binding
GO:0042802	identical protein binding
GO:0046872	metal ion binding
GO:0051219	phosphoprotein binding
GO:0097603	temperature-gated ion channel activity

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0001659	temperature homeostasis
GO:0001660	fever generation
GO:0001774	microglial cell activation
GO:0002024	diet induced thermogenesis
GO:0002790	peptide secretion
GO:0003085	negative regulation of systemic arterial blood pressure
GO:0006629	lipid metabolic process
GO:0006811	monoatomic ion transport
GO:0006816	calcium ion transport
GO:0007204	positive regulation of cytosolic calcium ion concentration
GO:0009268	response to pH
GO:0009408	response to heat
GO:0010459	negative regulation of heart rate
GO:0010917	negative regulation of mitochondrial membrane potential
GO:0014047	glutamate secretion
GO:0014832	urinary bladder smooth muscle contraction
GO:0019233	sensory perception of pain
GO:0019722	calcium-mediated signaling
GO:0034220	monoatomic ion transmembrane transport
GO:0034605	cellular response to heat
GO:0043065	positive regulation of apoptotic process
GO:0043434	response to peptide hormone
GO:0045429	positive regulation of nitric oxide biosynthetic process
GO:0048265	response to pain
GO:0048266	behavioral response to pain
GO:0050909	sensory perception of taste
GO:0050954	sensory perception of mechanical stimulus
GO:0050955	thermoception
GO:0050960	detection of temperature stimulus involved in thermoception
GO:0050965	detection of temperature stimulus involved in sensory perception of pain
GO:0050968	detection of chemical stimulus involved in sensory perception of pain
GO:0051289	protein homotetramerization
GO:0055085	transmembrane transport
GO:0060079	excitatory postsynaptic potential
GO:0060083	smooth muscle contraction involved in micturition
GO:0070588	calcium ion transmembrane transport
GO:0071312	cellular response to alkaloid
GO:0071318	cellular response to ATP
GO:0071345	cellular response to cytokine stimulus
GO:0071356	cellular response to tumor necrosis factor
GO:0071363	cellular response to growth factor stimulus
GO:0071468	cellular response to acidic pH
GO:0071502	cellular response to temperature stimulus
GO:0090212	negative regulation of establishment of blood-brain barrier
GO:0098703	calcium ion import across plasma membrane
GO:1901594	response to capsazepine
GO:1990090	cellular response to nerve growth factor stimulus

	Cellular Component
GO:0005886	plasma membrane
GO:0009897	external side of plasma membrane
GO:0016020	membrane
GO:0030425	dendrite
GO:0032591	dendritic spine membrane
GO:0042995	cell projection
GO:0043005	neuron projection
GO:0043025	neuronal cell body
GO:0045202	synapse
GO:0045211	postsynaptic membrane
GO:0098982	GABA-ergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8t0c, PDBe:8t0c, PDBj:8t0c
PDBsum	8t0c
PubMed	38698206
UniProt	O35433\|TRPV1_RAT Transient receptor potential cation channel subfamily V member 1 (Gene Name=Trpv1)

[Back to BioLiP]