Structure of PDB 8t04 Chain A

Receptor sequence
>8t04A (length=199) Species: 10090 (Mus musculus) [Search protein sequence]
VAKLLLPTLSSLAFLPTVSIATKRRFYMEAMVYLFTMFFVAFSHACDGPG
LSVLCFMRRDILEYFSIYGTALSMWVSLMALADFDEPQRSTFTMLGVLTI
AVRTFHDRWGYGVYSGPIGTATLIIAVKWLKKMKEKKGLYPDKSIYTQQI
GPGLCFGALALMLRFFFEEWDYTYVHSFYHCALAMSFVLLLPKVNKKAG
3D structure
PDB8t04 Cryo-EM structures of Myomaker reveal a molecular basis for myoblast fusion.
ChainA
Resolution2.98 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A H48 H180 H184 H44 H176 H180
BS02 CLR A W79 L99 T103 R107 G116 G120 T124 W75 L95 T99 R103 G112 G116 T120
BS03 LBN A M78 W113 Y115 G116 Y118 S119 L158 G161 L165 F191 L194 M74 W109 Y111 G112 Y114 S115 L154 G157 L161 F187 L190
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0007517 muscle organ development
GO:0007520 myoblast fusion
GO:0014905 myoblast fusion involved in skeletal muscle regeneration
GO:0043403 skeletal muscle tissue regeneration
GO:0045026 plasma membrane fusion
GO:1904206 positive regulation of skeletal muscle hypertrophy
Cellular Component
GO:0000139 Golgi membrane
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8t04, PDBe:8t04, PDBj:8t04
PDBsum8t04
PubMed37770716
UniProtQ9D1N4|MYMK_MOUSE Protein myomaker (Gene Name=Mymk)

[Back to BioLiP]