Structure of PDB 8sza Chain A

Receptor sequence

>8szaA (length=101) Species: 9606 (Homo sapiens) [Search protein sequence]

NHYASKKSAAESMLDIALLMANASQLKAVVEQGPSFAFYVPLVVLISISL
VLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITA
F

3D structure

PDB

8sza How NINJ1 mediates plasma membrane rupture and why NINJ2 cannot

Chain

Resolution

2.75 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLR	A	L97 F100 Y104 L118	L59 F62 Y66 L80

Gene Ontology

	Molecular Function
GO:0001530	lipopolysaccharide binding
GO:0005515	protein binding
GO:0098631	cell adhesion mediator activity
GO:0140912	membrane destabilizing activity

	Biological Process
GO:0001525	angiogenesis
GO:0002232	leukocyte chemotaxis involved in inflammatory response
GO:0006954	inflammatory response
GO:0007155	cell adhesion
GO:0007399	nervous system development
GO:0019835	cytolysis
GO:0031640	killing of cells of another organism
GO:0034113	heterotypic cell-cell adhesion
GO:0034145	positive regulation of toll-like receptor 4 signaling pathway
GO:0042246	tissue regeneration
GO:0042692	muscle cell differentiation
GO:0045766	positive regulation of angiogenesis
GO:0050729	positive regulation of inflammatory response
GO:0051260	protein homooligomerization
GO:0071474	cellular hyperosmotic response
GO:0097300	programmed necrotic cell death
GO:0097707	ferroptosis
GO:0141201	pyroptotic cell death

External links

PDB	RCSB:8sza, PDBe:8sza, PDBj:8sza
PDBsum	8sza
PubMed
UniProt	Q92982\|NINJ1_HUMAN Ninjurin-1 (Gene Name=NINJ1)