Structure of PDB 8syd Chain A

Receptor sequence

>8sydA (length=360) Species: 262724 (Thermus thermophilus HB27)

MWVKILSVVGARPQFIKAAAVSRVLRASPGVREVLVHTGQHYDDNMSQVF
FEELEIPDPDYHLGIGGGTHGQNTGRMLEAIEGVLLKEKPDWVLVYGNTD
STLAGALAAVKLHIPVAHVEAGLRSFNRRMPEEINRILTDHASDLLFAPT
ETAVQNLLREGIPENRIHLVGDVMYDAALHYGAKAERKSRILERLGLQAK
GYVLATIHRAENTDDQERLRVILEALAEVHQEVPVVFPVHPRTRKRAEAF
GLGSYLEKVVALEPVGYLDMVMLEKNARLIVTDSGGVQKEAYFYRVPCVT
VREETEWVELLKAEWNYLAAPQNAKDLALTILHRMRTKGVEIDLYGDGRA
SQKISDFLRK

3D structure

• PDB: 8syd Structural analysis of a bacterial UDP-sugar 2-epimerase reveals the active site architecture before and after catalysis.
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 5.1.3.14: UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MJL	A	R12 P13 Q14 I16 K17 F50 G97 N98 E120 E132 R136 H208 R209 V265 Y267 M270 S284 G285 G286 E290 E306 W307	R12 P13 Q14 I16 K17 F50 G97 N98 E120 E132 R136 H208 R209 V265 Y267 M270 S284 G285 G286 E290 E306 W307
BS02	UD1	A	P13 Q40 H41 Y42 D43 G67 T99 D100 E132 H208 R209 H240 P241 R242 K245	P13 Q40 H41 Y42 D43 G67 T99 D100 E132 H208 R209 H240 P241 R242 K245

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003824 catalytic activity
• GO:0008761 UDP-N-acetylglucosamine 2-epimerase activity
• GO:0016853 isomerase activity

External links

• PDB: RCSB:8syd, PDBe:8syd, PDBj:8syd
• PDBsum: 8syd
• PubMed: 37660908
• UniProt: Q72KY0