Structure of PDB 8skb Chain A

Receptor sequence

>8skbA (length=325) Species: 468946 (Myrciaria dubia)

DYGAFTYENLEREPYWPSEKLRISITGAGGFIASHIARRLKSEGHYIIAS
DWKKNEHMTEDMFCHEFHLVDLRVMDNCLKVTKGVDHVFNLAADMQSNHS
VIMYNNTMISFNMLEAARINGVKRFFYASSACIYPEFTNVSLKESDAWPA
EPQDAYGLEKLATEELCKHYTKDFGIECRIGRFHNIYGPFGTWKGGREKA
PAAFCRKTLTSTDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVN
IGSDEMVSMNEMAEIVLGFENKNLPIHHIPGPVRGRNSDNTLIKEKLGWA
PTMRLRDGLRITYFWIKEQIEKEKA

3D structure

• PDB: 8skb Structural insights into the Smirnoff-Wheeler pathway for vitamin C production in the Amazon fruit Camu-Camu.
• Chain: A
• Resolution: 2.58 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	A	G34 G37 F38 I39 D58 W59 L79 L98 A100 M102 I122 A141 S142 S143 Y173 K177 F200 H201 I203	G27 G30 F31 I32 D51 W52 L72 L91 A93 M95 I109 A128 S129 S130 Y156 K160 F183 H184 I186

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 30 14:16:50 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8skb', asym_id = 'A', title = 'Structural insights into the Smirnoff-Wheeler pa...tamin C production in the Amazon fruit Camu-Camu.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8skb', asym_id='A', title='Structural insights into the Smirnoff-Wheeler pa...tamin C production in the Amazon fruit Camu-Camu.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0047918,0051287', uniprot = '', pdbid = '8skb', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0047918,0051287', uniprot='', pdbid='8skb', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>