Structure of PDB 8sjx Chain A

Receptor sequence
>8sjxA (length=220) Species: 9940 (Ovis aries) [Search protein sequence]
SASFWRAIFAEFFATLFYVFFGLGASLRWAPGPLHVLQVALAFGLALATL
VQAVGHISGAHVNPAVTFAFLVGSQMSLLRAICYVVAQLLGAVAGAAVLY
SVTPPAVRGNLALNTLHPGVSVGQATIVEIFLTLQFVLCIFATYDERRNG
RLGSVALAVGFSLTLGHLFGMYYTGAGMNPARSFAPAILTRNFTNHWVYW
VGPVIGAGLGSLLYDFLLFP
3D structure
PDB8sjx Structure of aquaporin-0 arrays in sphingomyelin/cholesterol membranes and implications for lipid
ChainA
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HWP A I193 F198 I188 F193
BS02 HWP A V91 L94 L95 Y105 L194 R196 V86 L89 L90 Y100 L189 R191
BS03 HWP A Y105 S106 Y100 S101
BS04 HWP A W10 F14 F17 V91 L95 W5 F9 F12 V86 L90
BS05 HWP A W10 F14 L95 W5 F9 L90
BS06 CLR A I87 F198 W205 I82 F193 W200
Gene Ontology
Molecular Function
GO:0005212 structural constituent of eye lens
GO:0005515 protein binding
GO:0005516 calmodulin binding
GO:0015250 water channel activity
GO:0015267 channel activity
Biological Process
GO:0002088 lens development in camera-type eye
GO:0006833 water transport
GO:0007601 visual perception
GO:0045785 positive regulation of cell adhesion
GO:0051289 protein homotetramerization
GO:0055085 transmembrane transport
GO:1990349 gap junction-mediated intercellular transport
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005886 plasma membrane
GO:0005921 gap junction
GO:0016020 membrane
GO:0016324 apical plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8sjx, PDBe:8sjx, PDBj:8sjx
PDBsum8sjx
PubMed
UniProtQ6J8I9|MIP_SHEEP Lens fiber major intrinsic protein (Gene Name=MIP)

[Back to BioLiP]