Structure of PDB 8sjc Chain A

Receptor sequence

>8sjcA (length=87) Species: 9606 (Homo sapiens) [Search protein sequence]

MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKG
ADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSH

3D structure

PDB

8sjc Crystal structure of Zn2+ bound calprotectin

Chain

Resolution

1.87 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CA	A	D59 N61 D63 A65 E70	D59 N61 D63 A65 E70
BS02	CA	A	S20 K23 N25 A28 Y30	S20 K23 N25 A28 Y30
BS03	ZN	A	H17 H27	H17 H27

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0008017	microtubule binding
GO:0008270	zinc ion binding
GO:0035662	Toll-like receptor 4 binding
GO:0046872	metal ion binding
GO:0048306	calcium-dependent protein binding
GO:0050544	arachidonate binding
GO:0050786	RAGE receptor binding

	Biological Process
GO:0002523	leukocyte migration involved in inflammatory response
GO:0002544	chronic inflammatory response
GO:0002790	peptide secretion
GO:0002793	positive regulation of peptide secretion
GO:0006914	autophagy
GO:0006915	apoptotic process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0006935	chemotaxis
GO:0006954	inflammatory response
GO:0010043	response to zinc ion
GO:0014002	astrocyte development
GO:0018119	peptidyl-cysteine S-nitrosylation
GO:0030307	positive regulation of cell growth
GO:0030593	neutrophil chemotaxis
GO:0032119	sequestering of zinc ion
GO:0032496	response to lipopolysaccharide
GO:0034121	regulation of toll-like receptor signaling pathway
GO:0035425	autocrine signaling
GO:0042742	defense response to bacterium
GO:0045087	innate immune response
GO:0045471	response to ethanol
GO:0050729	positive regulation of inflammatory response
GO:0050832	defense response to fungus
GO:0051092	positive regulation of NF-kappaB transcription factor activity
GO:0051493	regulation of cytoskeleton organization
GO:0070488	neutrophil aggregation
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005886	plasma membrane
GO:0034774	secretory granule lumen
GO:0045111	intermediate filament cytoskeleton
GO:0062023	collagen-containing extracellular matrix
GO:0070062	extracellular exosome
GO:1990660	calprotectin complex

External links

PDB	RCSB:8sjc, PDBe:8sjc, PDBj:8sjc
PDBsum	8sjc
PubMed
UniProt	P05109\|S10A8_HUMAN Protein S100-A8 (Gene Name=S100A8)