Structure of PDB 8sg5 Chain A

Receptor sequence

>8sg5A (length=456) Species: 9606 (Homo sapiens) [Search protein sequence]

ALYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKFDTECYKKYGKMW
GTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAE
DEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTL
KDIFGAYSMDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLS
IILFPFLTPVFEALNVSLFPKDTINFLSKSVNRMKKSDFLQLMIDSQKAL
SDLELAAQSIIFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLP
NKAPPTYDAVVQMEYLDMVVNETLRLFPVAIRLERTCKKDVEINGVFIPK
GSMVVIPTYALHHDPKYWTEPEEFRPERFSKKKDSIDPYIYTPFGTGPRN
CIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVL
KVDSRD

3D structure

PDB

8sg5 Differential Effects of Clotrimazole on X-Ray Crystal Structures of Human Cytochrome P450 (CYP) 3A5 and 3A4.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.14.14.1: unspecific monooxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEM	A	R105 I118 R130 A305 L373 R375 P433 F434 R439 N440 C441 I442 A447	R83 I96 R108 A265 L333 R335 P393 F394 R399 N400 C401 I402 A407
BS02	CL6	A	R105 F213 F304 A305 T309 L481	R83 F191 F264 A265 T269 L441
BS03	CL6	A	S119 L120 F213 F220 L240 F241	S97 L98 F191 F198 L218 F219
BS04	CL6	A	Y53 E76 R106 F213 G214 F215 L216 D217 T478 G480	Y31 E54 R84 F191 G192 F193 L194 D195 T438 G440

Gene Ontology

	Molecular Function
GO:0004497	monooxygenase activity
GO:0005506	iron ion binding
GO:0005515	protein binding
GO:0008401	retinoic acid 4-hydroxylase activity
GO:0016491	oxidoreductase activity
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
GO:0019825	oxygen binding
GO:0020037	heme binding
GO:0046872	metal ion binding
GO:0050649	testosterone 6-beta-hydroxylase activity
GO:0070330	aromatase activity
GO:0101020	estrogen 16-alpha-hydroxylase activity

	Biological Process
GO:0002933	lipid hydroxylation
GO:0006805	xenobiotic metabolic process
GO:0008202	steroid metabolic process
GO:0008210	estrogen metabolic process
GO:0009822	alkaloid catabolic process
GO:0042178	xenobiotic catabolic process
GO:0042572	retinol metabolic process
GO:0042573	retinoic acid metabolic process
GO:0046222	aflatoxin metabolic process
GO:0070989	oxidative demethylation

	Cellular Component
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0016020	membrane
GO:0043231	intracellular membrane-bounded organelle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8sg5, PDBe:8sg5, PDBj:8sg5
PDBsum	8sg5
PubMed	37770228
UniProt	P20815\|CP3A5_HUMAN Cytochrome P450 3A5 (Gene Name=CYP3A5)

[Back to BioLiP]