Structure of PDB 8scz Chain A

Receptor sequence

>8sczA (length=635) Species: 9606 (Homo sapiens)

KPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKG
KVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENN
DIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYL
DQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIAT
VKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICK
DLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLY
TSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFE
EKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVD
ALKNWIEGNPKLSFLKPGILDHNILIATSVAQCNLVILYEYVGRARGSKC
FLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEK
FIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAF
KECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIK
IESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEM

3D structure

• PDB: 8scz Cryo-EM structure of 14aa-GS RIG-I in complex with p3SLR30
• Chain: A
• Resolution: 3.4 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	N298 Q299 I300 S325 G326 K379 Q380 D416 K418 Q507 E510 Q511 V514 R546 K635 T636 R637 T697 S698 V718 K750 H830 F853 K861 I875 K888 K907 W908 K909	N57 Q58 I59 S84 G85 K138 Q139 D175 K177 Q266 E269 Q270 V273 R305 K394 T395 R396 T428 S429 V442 K462 H542 F565 K573 I587 K600 K619 W620 K621
BS02	ZN	A	C810 C813 C864 C869	C522 C525 C576 C581

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003690 double-stranded DNA binding
• GO:0003723 RNA binding
• GO:0003724 RNA helicase activity
• GO:0003725 double-stranded RNA binding
• GO:0003727 single-stranded RNA binding
• GO:0004386 helicase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0005525 GTP binding
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0031625 ubiquitin protein ligase binding
• GO:0038187 pattern recognition receptor activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0002230 positive regulation of defense response to virus by host
• GO:0002376 immune system process
• GO:0002735 positive regulation of myeloid dendritic cell cytokine production
• GO:0002753 cytoplasmic pattern recognition receptor signaling pathway
• GO:0009597 detection of virus
• GO:0009615 response to virus
• GO:0010467 gene expression
• GO:0010628 positive regulation of gene expression
• GO:0030334 regulation of cell migration
• GO:0032725 positive regulation of granulocyte macrophage colony-stimulating factor production
• GO:0032727 positive regulation of interferon-alpha production
• GO:0032728 positive regulation of interferon-beta production
• GO:0032755 positive regulation of interleukin-6 production
• GO:0032757 positive regulation of interleukin-8 production
• GO:0032760 positive regulation of tumor necrosis factor production
• GO:0034344 regulation of type III interferon production
• GO:0039529 RIG-I signaling pathway
• GO:0043330 response to exogenous dsRNA
• GO:0045087 innate immune response
• GO:0045944 positive regulation of transcription by RNA polymerase II
• GO:0051607 defense response to virus
• GO:0060760 positive regulation of response to cytokine stimulus
• GO:0071360 cellular response to exogenous dsRNA
• GO:0140374 antiviral innate immune response

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005856 cytoskeleton
• GO:0005886 plasma membrane
• GO:0005923 bicellular tight junction
• GO:0015629 actin cytoskeleton
• GO:0032587 ruffle membrane
• GO:0042995 cell projection
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8scz, PDBe:8scz, PDBj:8scz
• PDBsum: 8scz
• UniProt: O95786|RIGI_HUMAN Antiviral innate immune response receptor RIG-I (Gene Name=RIGI)