Structure of PDB 8sc3 Chain A

Receptor sequence
>8sc3A (length=445) Species: 9606 (Homo sapiens) [Search protein sequence]
KQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQRCGWSPAE
ELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPL
GPCQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGY
FADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWM
AGYTLITEFVGSGSRRTVAIMYQMAFTVGLVALTGLAYALPHWRWLQLAV
SLPTFLFLLYYPSFADLFRTPRLRKRTFILMYLWFTDSVLYQGLILHMGA
TSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVM
IFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCS
SLCDIGGIITPFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPE
3D structure
PDB8sc3 Structural basis of promiscuous substrate transport by Organic Cation Transporter 1.
ChainA
Resolution3.24 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZVJ A W217 M218 Q241 F244 W354 Y361 I446 C450 W199 M200 Q223 F226 W284 Y291 I376 C380
Gene Ontology
Molecular Function
GO:0005277 acetylcholine transmembrane transporter activity
GO:0005326 neurotransmitter transmembrane transporter activity
GO:0005330 dopamine:sodium symporter activity
GO:0005334 norepinephrine:sodium symporter activity
GO:0005515 protein binding
GO:0008504 monoamine transmembrane transporter activity
GO:0008514 organic anion transmembrane transporter activity
GO:0015101 organic cation transmembrane transporter activity
GO:0015132 prostaglandin transmembrane transporter activity
GO:0015214 pyrimidine nucleoside transmembrane transporter activity
GO:0015234 thiamine transmembrane transporter activity
GO:0015489 putrescine transmembrane transporter activity
GO:0015606 spermidine transmembrane transporter activity
GO:0015651 quaternary ammonium group transmembrane transporter activity
GO:0019534 toxin transmembrane transporter activity
GO:0022857 transmembrane transporter activity
GO:0042802 identical protein binding
GO:0042910 xenobiotic transmembrane transporter activity
GO:1901235 (R)-carnitine transmembrane transporter activity
Biological Process
GO:0006805 xenobiotic metabolic process
GO:0006811 monoatomic ion transport
GO:0006812 monoatomic cation transport
GO:0006836 neurotransmitter transport
GO:0006837 serotonin transport
GO:0010248 establishment or maintenance of transmembrane electrochemical gradient
GO:0015695 organic cation transport
GO:0015697 quaternary ammonium group transport
GO:0015732 prostaglandin transport
GO:0015844 monoamine transport
GO:0015847 putrescine transport
GO:0015848 spermidine transport
GO:0015870 acetylcholine transport
GO:0015872 dopamine transport
GO:0015874 norepinephrine transport
GO:0015888 thiamine transport
GO:0042908 xenobiotic transport
GO:0048241 epinephrine transport
GO:0051610 serotonin uptake
GO:0051620 norepinephrine uptake
GO:0055085 transmembrane transport
GO:0071934 thiamine transmembrane transport
GO:0072237 metanephric proximal tubule development
GO:0072530 purine-containing compound transmembrane transport
GO:0090494 dopamine uptake
GO:0098655 monoatomic cation transmembrane transport
GO:0150104 transport across blood-brain barrier
GO:1902270 (R)-carnitine transmembrane transport
GO:1902616 acyl carnitine transmembrane transport
GO:1903711 spermidine transmembrane transport
GO:1990748 cellular detoxification
GO:1990962 xenobiotic transport across blood-brain barrier
Cellular Component
GO:0005886 plasma membrane
GO:0009925 basal plasma membrane
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0016324 apical plasma membrane
GO:0016328 lateral plasma membrane
GO:0098793 presynapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8sc3, PDBe:8sc3, PDBj:8sc3
PDBsum8sc3
PubMed37821493
UniProtO15245|S22A1_HUMAN Solute carrier family 22 member 1 (Gene Name=SLC22A1)

[Back to BioLiP]