Structure of PDB 8s9o Chain A

Receptor sequence

>8s9oA (length=230) Species: 104782 (Adineta vaga)

SNSDSFQKKKLKSFTNKYVVLDSLEGLRSLPDNSVQCVVTSPPYNKLNED
DYQKWQLQILNEINRILKPGGSAFYNHKDHPPEKFLSDSDLELYQTIIWD
RGSTVNQNARYFRPYVEKIFWFTKSISGESTTPKFHRDRLPEYFKGVIWR
IPPDKRNKHPAPFPAILAEICILTTTEEGDLVLDPFAGSGTTLVAAASLK
RSYLGFDISSKYQKMFHQRLATSKSKVHLW

3D structure

• PDB: 8s9o Biochemical and structural characterization of the first-discovered metazoan DNA cytosine-N4 methyltransferase from the bdelloid rotifer Adineta vaga.
• Chain: A
• Resolution: 1.94 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SFG	A	S89 S107 P109 L113 K165 H253 A255 P256 F257 F280 A281 G282 S283 T285 D301 I302 Y306	S23 S41 P43 L47 K78 H159 A161 P162 F163 F186 A187 G188 S189 T191 D207 I208 Y212

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 14:36:49 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8s9o', asym_id = 'A', title = 'Biochemical and structural characterization of t...nsferase from the bdelloid rotifer Adineta vaga. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8s9o', asym_id='A', title='Biochemical and structural characterization of t...nsferase from the bdelloid rotifer Adineta vaga. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003677,0008170,0009307,0015667', uniprot = '', pdbid = '8s9o', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0008170,0009307,0015667', uniprot='', pdbid='8s9o', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>