Structure of PDB 8s9n Chain A

Receptor sequence
>8s9nA (length=224) Species: 104782 (Adineta vaga) [Search protein sequence]
NSDSFQKKKLKSFTNKYVVLDSLEGLRSLPDNSVQCVVTSPPYNEDDYQK
WQLQILNEINRILKPGGSAFYNHKPPEKFLSDSDLELYQTIIWDRGSTVN
QNARYFRPYVEKIFWFTKSISGESTTPKFHRDRLPEYFKGVIWRIPPDKR
NKHPAPFPAILAEICILTTTEEGDLVLDPFAGSGTTLVAAASLKRSYLGF
DISSKYQKMFHQRLATSKSKVHLW
3D structure
PDB8s9n Biochemical and structural characterization of the first-discovered metazoan DNA cytosine-N4 methyltransferase from the bdelloid rotifer Adineta vaga.
ChainA
Resolution1.89 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SFG A S89 S107 P109 H253 A255 P256 F257 F280 A281 S283 T285 D301 I302 Y306 S22 S40 P42 H153 A155 P156 F157 F180 A181 S183 T185 D201 I202 Y206
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 19:06:44 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8s9n', asym_id = 'A', title = 'Biochemical and structural characterization of t...nsferase from the bdelloid rotifer Adineta vaga. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8s9n', asym_id='A', title='Biochemical and structural characterization of t...nsferase from the bdelloid rotifer Adineta vaga. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003677,0008170,0009307,0015667', uniprot = '', pdbid = '8s9n', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0008170,0009307,0015667', uniprot='', pdbid='8s9n', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>