Structure of PDB 8s96 Chain A

Receptor sequence

>8s96A (length=124) Species: 9913 (Bos taurus)

KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHES
LADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTT
QANKHIIVACEGNPYVPVHFDASV

3D structure

• PDB: 8s96 Experimental and Computational Studies for the Effect of Lengthening the Phosphate Chain of Nucleotide on the RNase A Inhibitors.
• Chain: A
• Resolution: 1.68 Å

Enzymatic activity

• Enzyme Commision number: 4.6.1.18: pancreatic ribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZSF	A	K7 Q11 H12 R39 K41 N67 Q69 N71 A109 H119 F120	K7 Q11 H12 R39 K41 N67 Q69 N71 A109 H119 F120

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0004519 endonuclease activity
• GO:0004522 ribonuclease A activity
• GO:0004540 RNA nuclease activity
• GO:0005515 protein binding
• GO:0016829 lyase activity

Biological Process

• GO:0050830 defense response to Gram-positive bacterium

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:8s96, PDBe:8s96, PDBj:8s96
• PDBsum: 8s96
• PubMed: 39071052
• UniProt: P61823|RNAS1_BOVIN Ribonuclease pancreatic (Gene Name=RNASE1)