Structure of PDB 8s1k Chain A

Receptor sequence

>8s1kA (length=130) Species: 9606 (Homo sapiens) [Search protein sequence]

DAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITI
KSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKS
TTIKRKREDDKLVVECVMKGVTSTRVYERA

3D structure

PDB

8s1k Crystal Structure of a human FABP4 complex

Chain

Resolution

1.22 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	A1H4Y	A	F16 M20 T29 A36 P38 S53 S55 K58 A75 D76 I104 C117 R126 Y128	F15 M19 T28 A35 P37 S52 S54 K57 A74 D75 I103 C116 R125 Y127

Gene Ontology

	Molecular Function
GO:0005324	long-chain fatty acid transmembrane transporter activity
GO:0005504	fatty acid binding
GO:0008289	lipid binding
GO:0036041	long-chain fatty acid binding
GO:0051427	hormone receptor binding

	Biological Process
GO:0009617	response to bacterium
GO:0015908	fatty acid transport
GO:0015909	long-chain fatty acid transport
GO:0042632	cholesterol homeostasis
GO:0045892	negative regulation of DNA-templated transcription
GO:0050729	positive regulation of inflammatory response
GO:0050872	white fat cell differentiation
GO:0050873	brown fat cell differentiation
GO:0071285	cellular response to lithium ion
GO:0071356	cellular response to tumor necrosis factor
GO:0120162	positive regulation of cold-induced thermogenesis

External links

PDB	RCSB:8s1k, PDBe:8s1k, PDBj:8s1k
PDBsum	8s1k
PubMed
UniProt	P15090\|FABP4_HUMAN Fatty acid-binding protein, adipocyte (Gene Name=FABP4)