Structure of PDB 8rxn Chain A

Receptor sequence

>8rxnA (length=52) Species: 881 (Nitratidesulfovibrio vulgaris)

MKKYVCTVCGYEYDPAEGDPDNGVKPGTSFDDLPADWVCPVCGAPKSEFE
AA

3D structure

• PDB: 8rxn Refinement of rubredoxin from Desulfovibrio vulgaris at 1.0 A with and without restraints.
• Chain: A
• Resolution: 1.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FE	A	C6 C9 C39 C42	C6 C9 C39 C42

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding

Biological Process

• GO:0043448 alkane catabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:8rxn, PDBe:8rxn, PDBj:8rxn
• PDBsum: 8rxn
• PubMed: 1616692
• UniProt: P00269|RUBR_NITV2 Rubredoxin (Gene Name=rub)