Structure of PDB 8rj6 Chain A

Receptor sequence

>8rj6A (length=214) Species: 562 (Escherichia coli)

MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAK
DIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAG
INVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTG
EELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTK
PVAEVRADLEKILG

3D structure

• PDB: 8rj6 Insights into Enzymatic Catalysis from Binding and Hydrolysis of Diadenosine Tetraphosphate by
• Chain: A
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	A	G10 G12 K13 G14 T15 R119 R123 V132 Y133 H134 F137 K200 V202	G10 G12 K13 G14 T15 R119 R123 V132 Y133 H134 F137 K200 V202
BS02	ADP	A	G10 G12 K13 G14 T15 R119 R123 V132 Y133 H134 F137 K200 V202	G10 G12 K13 G14 T15 R119 R123 V132 Y133 H134 F137 K200 V202
BS03	AMP	A	T31 G32 L35 R36 M53 K57 V59 V64 G85 R88 Q92 R156 R167	T31 G32 L35 R36 M53 K57 V59 V64 G85 R88 Q92 R156 R167

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004017 adenylate kinase activity
• GO:0004550 nucleoside diphosphate kinase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016208 AMP binding
• GO:0016301 kinase activity
• GO:0050145 nucleoside monophosphate kinase activity

Biological Process

• GO:0006172 ADP biosynthetic process
• GO:0009123 nucleoside monophosphate metabolic process
• GO:0009132 nucleoside diphosphate metabolic process
• GO:0009165 nucleotide biosynthetic process
• GO:0015951 purine ribonucleotide interconversion
• GO:0016310 phosphorylation
• GO:0044209 AMP salvage
• GO:0046940 nucleoside monophosphate phosphorylation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:8rj6, PDBe:8rj6, PDBj:8rj6
• PDBsum: 8rj6
• PubMed: 39121211
• UniProt: P69441|KAD_ECOLI Adenylate kinase (Gene Name=adk)