Structure of PDB 8rfc Chain A |
>8rfcA (length=118) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search protein sequence] |
MEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEK GVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLV PHVGEIPVAYRKVLLRKN |
|
PDB | 8rfc High-confidence placement of low-occupancy fragments into electron density using the anomalous signal of sulfur and halogen atoms. |
Chain | A |
Resolution | 1.1 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
A1H0N |
A |
H45 P109 |
H37 P101 |
|
|
|