Structure of PDB 8qsk Chain A

Receptor sequence
>8qskA (length=523) Species: 9606 (Homo sapiens) [Search protein sequence]
GARRAAAAAAAAGAFAGRRAACGAVLLTELLERAAFYGITSNLVLFLNGA
PFCWEGAQASEALLLFMGLTYLGSPFGGWLADARLGRARAILLSLALYLL
GMLAFPLLAAPATRAALCGSARLLNCTAPGPDAAARCCSPATFAGLVLVG
LGVATVKANITPFGADQVKDRGPEATRRFFNWFYWSINLGAILSLGGIAY
IQQNVSFVTGYAIPTVCVGLAFVVFLCGQSVFITKPPDGSAFTDMFKILT
YSCCSQKRFDSCKMSHGGPFTEEKVEDVKALVKIVPVFLALIPYWTVYFQ
MQTTYVLQSLHLRIPEISNITTTPHTLPAAWLTMFDAVLILLLIPLKDKL
VDPILRRHGLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQ
TIGNVVYHAADLSLWWQVPQYLLIGISEIFASIAGLEFAYSAAPKSMQSA
IMGLFFFFSGVGSFVGSGLLALVSIKAIGWMSSHTDFGNINGCYLNYYFF
LLAAIQGATLLLFLIISVKYDHH
3D structure
PDB8qsk Cryo-EM structure of human SLC15A4 dimer in outward open state in MSP1D1 nanodisc
ChainA
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 Y01 A A418 I421 L422 K425 W453 A381 I384 L385 K388 W416
BS02 Y01 A L398 F467 L361 F430
BS03 Y01 A D448 S450 W452 W453 V455 D411 S413 W415 W416 V418
BS04 Y01 A F501 G505 F464 G468
BS05 Y01 A L326 I553 L289 I516
BS06 Y01 A Y534 F537 L538 A541 Y497 F500 L501 A504
BS07 Y01 A F417 A541 G544 F380 A504 G507
BS08 Y01 A L548 I552 V555 L511 I515 V518
Gene Ontology
Molecular Function
GO:0005290 L-histidine transmembrane transporter activity
GO:0005515 protein binding
GO:0015293 symporter activity
GO:0015333 peptide:proton symporter activity
GO:0015647 peptidoglycan transmembrane transporter activity
GO:0022857 transmembrane transporter activity
GO:0071916 dipeptide transmembrane transporter activity
Biological Process
GO:0006811 monoatomic ion transport
GO:0006857 oligopeptide transport
GO:0015031 protein transport
GO:0015817 histidine transport
GO:0015833 peptide transport
GO:0015835 peptidoglycan transport
GO:0033023 mast cell homeostasis
GO:0034157 positive regulation of toll-like receptor 7 signaling pathway
GO:0034161 positive regulation of toll-like receptor 8 signaling pathway
GO:0034165 positive regulation of toll-like receptor 9 signaling pathway
GO:0045087 innate immune response
GO:0045089 positive regulation of innate immune response
GO:0048302 regulation of isotype switching to IgG isotypes
GO:0055085 transmembrane transport
GO:0070424 regulation of nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway
GO:0070430 positive regulation of nucleotide-binding oligomerization domain containing 1 signaling pathway
GO:0070434 positive regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway
GO:0089708 L-histidine transmembrane export from vacuole
GO:0140206 dipeptide import across plasma membrane
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005768 endosome
GO:0005886 plasma membrane
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0031901 early endosome membrane
GO:0035579 specific granule membrane
GO:0036020 endolysosome membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qsk, PDBe:8qsk, PDBj:8qsk
PDBsum8qsk
PubMed
UniProtQ8N697|S15A4_HUMAN Solute carrier family 15 member 4 (Gene Name=SLC15A4)

[Back to BioLiP]