Structure of PDB 8qll Chain A

Receptor sequence

>8qllA (length=237) Species: 10116 (Rattus norvegicus)

SARSLGKGSAPPGPVPEGQIRVYSMRFCPFAQRTLMVLKAKGIRHEIINI
NLKNKPEWFFEKNPFGLVPVLENTQGHLITESVITCEYLDEAYPEKKLFP
DDPYEKACQKMTFELFSKVPSLVTSFIRAKRKEDHPGIKEELKKEFSKLE
EAMANKRTAFFGGNSLSMIDYLIWPWFQRLEALELNECIDHTPKLKLWMA
TMQEDPVASSHFIDAKTYRDYLSLYLQDSPEACDYGL

3D structure

• PDB: 8qll Rattus norvegicus Glutathione Transferase Omega 1 Localization in Oral Tissues and Interactions with Food Phytochemicals.
• Chain: A
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GSH	A	C32 F34 L56 K59 L71 V72 E85 S86	C28 F30 L52 K55 L67 V68 E81 S82

Gene Ontology

Molecular Function

• GO:0004364 glutathione transferase activity
• GO:0016491 oxidoreductase activity
• GO:0016740 transferase activity
• GO:0045174 glutathione dehydrogenase (ascorbate) activity
• GO:0050610 methylarsonate reductase activity

Biological Process

• GO:0006749 glutathione metabolic process
• GO:0010880 regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
• GO:0019852 L-ascorbic acid metabolic process
• GO:0019853 L-ascorbic acid biosynthetic process
• GO:0042178 xenobiotic catabolic process
• GO:0071243 cellular response to arsenic-containing substance
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005604 basement membrane
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0030424 axon
• GO:0031965 nuclear membrane
• GO:0044297 cell body

External links

• PDB: RCSB:8qll, PDBe:8qll, PDBj:8qll
• PDBsum: 8qll
• PubMed: 38441878
• UniProt: Q9Z339|GSTO1_RAT Glutathione S-transferase omega-1 (Gene Name=Gsto1)