Structure of PDB 8qh6 Chain A |
>8qh6A (length=128) Species: 623 (Shigella flexneri) [Search protein sequence] |
TLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYI MGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKA KECFELVIQHSNDEKLKIKAQSYLDAIQ |
|
PDB | 8qh6 Crystallographic Fragment Screening on the Shigella Type III Secretion System Chaperone IpgC. |
Chain | A |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
V9U |
A |
K101 Y104 |
K78 Y81 |
|
|
|
|