Structure of PDB 8qfw Chain A

Receptor sequence
>8qfwA (length=292) Species: 10090 (Mus musculus) [Search protein sequence]
GMARCERLRGAALRDVLGQAQGVLFDCDGVLWNGERIVPGAPELLQRLAR
AGKNTLFVSNNSRRARPELALRFARLGFAGLRAEQLFSSALCAARLLRQR
LSGPPDASGAVFVLGGEGLRAELRAAGLRLAGDPGEDPRVRAVLVGYDEQ
FSFSRLTEACAHLRDPDCLLVATDRDPWHPLSDGSRTPGTGSLAAAVETA
SGRQALVVGKPSPYMFQCITEDFSVDPARTLMVGDRLETDILFGHRCGMT
TVLTLTGVSSLEEAQAYLTAGQRDLVPHYYVESIADLMEGLE
3D structure
PDB8qfw 7,8-Dihydroxyflavone is a direct inhibitor of pyridoxal phosphatase
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.3.16: protein-serine/threonine phosphatase.
3.1.3.74: pyridoxal phosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A D25 D27 D234 D26 D28 D235
BS02 PO4 A D25 D27 S58 N59 K209 D26 D28 S59 N60 K210
BS03 UK9 A D27 N60 S61 R62 Y146 E148 H178 P179 D28 N61 S62 R63 Y147 E149 H179 P180
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004721 phosphoprotein phosphatase activity
GO:0004722 protein serine/threonine phosphatase activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
GO:0017018 myosin phosphatase activity
GO:0031072 heat shock protein binding
GO:0033883 pyridoxal phosphatase activity
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
Biological Process
GO:0006470 protein dephosphorylation
GO:0007088 regulation of mitotic nuclear division
GO:0016311 dephosphorylation
GO:0030836 positive regulation of actin filament depolymerization
GO:0031247 actin rod assembly
GO:0032361 pyridoxal phosphate catabolic process
GO:0032465 regulation of cytokinesis
GO:0071318 cellular response to ATP
GO:0099159 regulation of modification of postsynaptic structure
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0005911 cell-cell junction
GO:0015629 actin cytoskeleton
GO:0030027 lamellipodium
GO:0030496 midbody
GO:0031258 lamellipodium membrane
GO:0032154 cleavage furrow
GO:0032587 ruffle membrane
GO:0042995 cell projection
GO:0070938 contractile ring
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qfw, PDBe:8qfw, PDBj:8qfw
PDBsum8qfw
PubMed38856179
UniProtP60487|PLPP_MOUSE Chronophin (Gene Name=Pdxp)

[Back to BioLiP]