Structure of PDB 8q5p Chain A

Receptor sequence

>8q5pA (length=245) Species: 9606 (Homo sapiens)

GPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTEMQCECTPLSKD
ERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILT
EKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFM
ALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVP
SGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGG

3D structure

• PDB: 8q5p Structural and enzymatic evidence for the methylation of the ACK1 tyrosine kinase by the histone lysine methyltransferase SETD2.
• Chain: A
• Resolution: 1.814 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-
  2.1.1.359: [histone H3]-lysine(36) N-trimethyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	M1526 F1589 A1597 Y1604 F1606 M1607 A1608 T1637 Q1638 K1639 Y1666 Q1667 F1668 Q1669 R1670 Y1671 G1672 K1673 E1674 A1700	M69 F132 A140 Y147 F149 M150 A151 T180 Q181 K182 Y209 Q210 F211 Q212 R213 Y214 G215 K216 E217 A243
BS02	ZN	A	C1499 C1501 C1516 C1520	C42 C44 C59 C63
BS03	ZN	A	C1516 C1529 C1533 C1539	C59 C72 C76 C82
BS04	ZN	A	C1631 C1678 C1680 C1685	C174 C221 C223 C228
BS05	SAM	A	K1560 G1561 W1562 H1603 Y1604 Y1605 R1625 F1626 N1628 H1629 Y1666 Q1676 C1678 F1679	K103 G104 W105 H146 Y147 Y148 R168 F169 N171 H172 Y209 Q219 C221 F222

Gene Ontology

Molecular Function

• GO:0016279 protein-lysine N-methyltransferase activity
• GO:0042054 histone methyltransferase activity
• GO:0046975 histone H3K36 methyltransferase activity

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:8q5p, PDBe:8q5p, PDBj:8q5p
• PDBsum: 8q5p
• PubMed: 38160530
• UniProt: Q9BYW2|SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 (Gene Name=SETD2)