Structure of PDB 8pro Chain A |
>8proA (length=80) Species: 309799 (Dictyoglomus thermophilum H-6-12) [Search protein sequence] |
TGGSVHSSPAIGQDGTIYVGSNDHYLYAINPNGKLKWKFETGGSVHSSPA IGQDGTIYVGSNDHYLYAINPNGKLKWKFE |
|
PDB | 8pro The structure of v13Bagel2 |
Chain | A |
Resolution | 1.7 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
IR0 |
A |
H6 N22 H46 N62 |
H6 N22 H46 N62 |
|
|
|