Structure of PDB 8pp7 Chain A

Receptor sequence
>8pp7A (length=98) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB8pp7 Structural basis of the histone ubiquitination read-write mechanism of RYBP-PRC1.
ChainA
Resolution2.91 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R42 R83 R116 V117 T118 R6 R47 R80 V81 T82
BS02 dna A R40 Y41 G44 V46 R49 R63 K64 L65 R69 R4 Y5 G8 V10 R13 R27 K28 L29 R33
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005700 polytene chromosome
GO:0035059 RCAF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pp7, PDBe:8pp7, PDBj:8pp7
PDBsum8pp7
PubMed38528151
UniProtP02299|H3_DROME Histone H3 (Gene Name=His3)

[Back to BioLiP]